SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|93250|fgenesh3_pg.131__17 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|93250|fgenesh3_pg.131__17
Domain Number 1 Region: 503-533
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000645
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|93250|fgenesh3_pg.131__17
Sequence length 591
Sequence
MAELEQCENAASWLWDENNKPISWKEQQLALEHWKSLKLSREAGSAGPAVPSAGNGRKPS
KHLGPITEIEPGSYLGRAFRSPEKCLGSQSGSADGTEPSSSLPDSSSDGKPSDSSSLLSS
GSSELITTFKKKKKRTRCTHAPVLKPKEPDVYDGSWDVQHFHKFMTEVTEKPYKWTLRNL
FTDLFNYCSPIDFHMKMCAKFNCCKQGDWTVYDFAHELDGLAKMSGVWSDREKVDKLWAS
LTFPIQRELWQKELTPTASRWDDVRVAAEIEKIASSVWHLAPTDHKPAKTHKSPSVTGSL
VDSCTSRRDHQGPRDRGGSLFVGGSTNARGPKSFDLPPLDLFCRIRRGQTCKLLDSVVHG
QALRPKPAGPSPAKPSKAWPKPAKALPEGPALVFSKPEPGLGPGAFGRILVVTAAVPPSL
TVSGTKYKVEDQSPMTNTSCCVMLKAFLQDHYIYTMVYSQYHNTHSPGLSLSQAQPKPGP
RGGPGLTLRPDPAAKSLAKSRALGPSRALNNTTAGKCFICRQPGHMSRNCPDAQWPDFAA
IDELHELAALTAMSDGLALHNIDLGCLGALSAMEESSYDAAGAYIILPITT
Download sequence
Identical sequences B8PGX9
jgi|Pospl1|93250|fgenesh3_pg.131__17 104341.JGI93250 XP_002474942.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]