SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|95047|fgenesh3_pg.126__28 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|95047|fgenesh3_pg.126__28
Domain Number 1 Region: 278-405
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000327
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 2 Region: 175-268
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000386
Family Tropomyosin 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|95047|fgenesh3_pg.126__28
Sequence length 687
Sequence
MATFSISTMNMSRRAPTPLRSTPSSAPLEAMVAKKQAHIEELIAQNRSLEHTIMKLRETI
NDEQARGRDAVAMVQQKWKQERTEWLEGCDSLQAAHRIAHLRTALELDRERAIILKVRED
MRLERLARLQRDNRLVAFQRRESELEARVEELSKELLDQQEVLANDQETLNQELEQCNVE
LADIKGQLRDAQEELVDVEKQKQKAEDALAKLRAEHTTLVASSGTTAINLERTTLQLDGL
KSSLSELETKHADAERTIADLRRQLEKWRSLESREGAEMETLRREKIDLEIRVKTLEASL
KEAETSIKGREEVVEKAQTKLEKYKHSIDEHKKAIVEAHEAADRAEAEAEEVKEQLAEAE
SKIKTLQEQLKAEKSRADEVAAQAQARSSATTKKSKTPASLSDARRSSENEVEVIVEAPS
PPPSPPPPQKPKPRPRPRSKVHAPVQDSDIEEIESPVQPPEKPAKKSAKSRGAPVAALDD
QASGPSRPKTRNEKSQPAPSAIADADDDDDDEEVMISEVTPKAKAKAKGKGKEKEKTNGK
EKAKPKAKPKGRDKDKDEDEDSANAQTAAKEKGKRKAIALDSDAEDVLDSSAPKKGSRKK
KARDEDENDGGVSQKPKPRAKPSKLPAKAPSYEASKGGSLDGFIVVAYILSFLPFVKVIA
LPIRIVFRPVSTLTISLPPLMYSAPPA
Download sequence
Identical sequences B8PGJ5
104341.JGI95047 XP_002474804.1.31404 jgi|Pospl1|95047|fgenesh3_pg.126__28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]