SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|96969|fgenesh3_pg.13__32 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|96969|fgenesh3_pg.13__32
Domain Number 1 Region: 236-590
Classification Level Classification E-value
Superfamily SPOC domain-like 5.69e-46
Family Ku80 subunit middle domain 0.00028
Further Details:      
 
Domain Number 2 Region: 1-218
Classification Level Classification E-value
Superfamily vWA-like 2.67e-28
Family Ku80 subunit N-terminal domain 0.0083
Further Details:      
 
Domain Number 3 Region: 678-814
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 6.67e-22
Family C-terminal domain of Ku80 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|96969|fgenesh3_pg.13__32
Sequence length 822
Sequence
MFLVDISPSMGKLREIEVPSGKDGELDTIEITNLELALQFVMLKIQEMAALTVATQIYNG
RKTDQCGVITFGSEETDNIIHEKHGGYENVSEYIPIGQPNAGTLAKLARLQPSTVIGDPI
DALIVGIETQHQYLSSKKTWTRKMVLLTDGENPIEVEDWEATVHKMNTVQIHLTVVGVDF
DDEYLPFLEEGKSNIKRANEEFYHTLAKSMAHGIVGNCDFALQELSRPDIKQTKSALLGT
VLRIGDVDARPEEAMEILVKTSKATAIARPKSWKKFARRQKEESQEEANIPLDEETEVYA
QLHMRTQYMIEKQPPEGEEDQPPVYEQLEGITKEELVRGFKYGSSYAPCPGGQFERLPTR
RGIDICGFFLEKNFRREWEMSEVTYVWADPAQPLQQVALSAVVQAMYEKGAMAIARWASR
DGMDPKMGVLRPTMFEKADCFMWVQTVEVNALSKMPFADDVRNFSFASLETLINKKGEVV
TDHPYLPTDEQMEAMEHFVDAMDLMDAGEKDEEGNREPWFDTRLSYNPVIHRTKQAQFHA
AIVADLNTHPLPPAHSELTKYFEPPKRVLKRSRDAIEECKQVFKIKEVPKRVVQTRKDGH
VRAGDEDEDMILLDKMPRRRLSKSASQFVASQQEASTSRSQVPRRKKSNPNDSATESETE
DEDEELLLDKKQLPTPVPDADEGSDAAPTARIVGTESPLEDFKDNISRGDLVTKAVEDLG
AVIKEIVLRPFSARRTEEMLQCMQELRKVCLEEDEVDAWNAFLPDLRQASVEKSGDPDFW
LRVRDLGRAISLISSSEASSLGGKSDISETNAVEVRSHAAWF
Download sequence
Identical sequences A0A1X6NHJ2 B8P2U8
jgi|Pospl1|96969|fgenesh3_pg.13__32 104341.JGI96969 XP_002469996.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]