SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|98310|fgenesh3_pg.7__151 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|98310|fgenesh3_pg.7__151
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000164
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|98310|fgenesh3_pg.7__151
Sequence length 361
Sequence
MSSTLPFLDQFNTPSTEGGKRISIYTPKHTHVGDSALLTLLLSNPTDVFNKLKTHHPEAT
NATNRAALEAHLSARHEYDEAVKAADEAINHHKRLLRQQDDRVLTELIQLDNLKVAHRFQ
PLLLRSIRAQHNKFIPRAIPNAYLPLPAPLPMSAFRRPPILSPFLQATPWSTTILADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCTGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEVKERKERERQTKAVPIPPPHSANPEPPASPVAGPSRPRPDTP
VVFRKVDPDWTPDTTQWTWDSSWLRQKHLEWKNLGRNAHNEWFDEEEDDGVDWELYGNGE
Q
Download sequence
Identical sequences B8P1C8
jgi|Pospl1|98310|fgenesh3_pg.7__151 XP_002469434.1.31404 104341.JGI98310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]