SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|98841|fgenesh3_pg.197__9 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|98841|fgenesh3_pg.197__9
Domain Number 1 Region: 470-499
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000127
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|98841|fgenesh3_pg.197__9
Sequence length 502
Sequence
MDAICDLRKCSVEYEPYGICLAPRPTVFIPHFTVAGRGYGGSGYKAKLYFAFSWFVCQQL
YSSNISSTITSNNTVNPVPLGLPALAGSPLLQYDQADRCFVTSTKRAPIYPRGGTWCHAT
GPNPQVIAHQELVSYYQRHPPAHPEDVFTILRIDVEPTQTAESVQSPINEQPLELPEVQY
VPIEIPDIELPPAPPASTNAPVEVPMATFTQADIDQCIAVALTAYQSQQSTANRPLRLDI
PAPEPFSGKAEDLRRFIQCVLSYFVATNNTQLSDEAKIAFTVALMRKDLGKTWADAYYEK
SAGGVQVYSTWANFVAALEEAFPEHGTRIKAHQILMKLPKQQRDRKTALSLGNYVTRFEQ
LASKAQLKDTEVNGTNRVENDYHTLHANFVKGLPKELYFALATRVARDRSNTMKAWYDEV
RNADTAKQGALVVTDTRDYGEPMDIDATAVASTFASTSGGRKWELGAVLNEADRKLHRDG
NLCFYCHIKGHSAKDCRKKAAA
Download sequence
Identical sequences B8PKK9
104341.JGI98841 jgi|Pospl1|98841|fgenesh3_pg.197__9 XP_002476218.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]