SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM02_V2.0400 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM02_V2.0400
Domain Number 1 Region: 335-410
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000272
Family PCI domain (PINT motif) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM02_V2.0400
Sequence length 532
Comment | organism=Leishmania_braziliensis | product=proteasome regulatory non-ATPase subunit 6, putative | location=Lbr.chr2:176638-178236(-) | length=532
Sequence
MIPGGSVDCAHTLEVAEDYYGKGDRRTARELLQSIVTTDVAVDDGDSIRAKEQAVYRLAE
LLTVTKDGEAAIQLLSDVRPFFQVLPKAKTTKMVRKLFEHIVQCGVPLKQQEAICLETVD
WARKERRTFLRHRLQLRYVEILFAENRKNDALASLSALLKEVRRLDDRTLLLDIYLLESK
LYYAVMDIQKARAALVSARTTANSIYCPPLSQAEIDLQSGVLHADEKDNKTAYSYLYEAF
EGFHQLGDQARQARRSLRYMILSKISTDSPDELATLLSSKSVLEYKGADVDALRGIADAY
NKQDTHLFNNILAKCRTEAEESGAGGGSDTNLLADEVVRRQVNDMYNTLLERHILKVVSP
YNRVQIAYVSSLLKLDAMVVEQKLSQLILDRKLRGIVDQQHRCLILFDDEAAEASKPDKD
GGEDFYDNAADAAAAADQAPTTLYQDALTALECYNTLVTALFDKINGKFDALVEENIAKH
RGAKAKENEDEANRKNKRGGISSTKDAAADRGGKNDKSDSGNKPTRPGDKRR
Download sequence
Identical sequences A4H3D3
XP_001561553.1.15230 gi|154331470|ref|XP_001561553.1| psu|LbrM02_V2.0400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]