SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM03_V2.0330 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LbrM03_V2.0330
Domain Number - Region: 270-318
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000408
Family PCI domain (PINT motif) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM03_V2.0330
Sequence length 347
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr3:99256-100299(+) | length=347
Sequence
MSDVSLALALLLLLAACGALLLWLISQRNTDSSTVGGPALARKKGRLRSAQSVSGSGACR
HGNNSEDESHQDEEDDNGGQDGAAGRRRIGAGGGLHRRRHQRRGANAHRGGSDGDENDHN
DDEGAGGIPDTDENGVKMTRLQRKKLAKEREREERRQAQEAALEAQRQRMDASELRDAEV
ARREEERKAAEEAALQQLREDKKKADDEEYAKWISHIGVEERGELGDEVRKRQARVQSFL
LDRAAQVQARAQRSAGGAHSSTSEEECIHVLVLQTAARDLIVSVEELVGTIERLSQADKV
HGVFDDRGKYIFIAPEQFPLLAQFIRLRGRVSVQEFTRECNRIVMQS
Download sequence
Identical sequences A4H3K4
XP_001561623.1.15230 gi|154331611|ref|XP_001561623.1| psu|LbrM03_V2.0330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]