SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM04_V2.0090 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LbrM04_V2.0090
Domain Number - Region: 51-141
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0009
Family Single-domain sulfurtransferase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM04_V2.0090
Sequence length 167
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr4:39242-39745(+) | length=167
Sequence
MAQWIPKTAWTVSNLNKRYGVQYVTKGYASLDPKCNLDAYTSLQHTVTSSYLKKALLSIS
CTSPGALVIDVRSEPERQLRPLKFSAIVALHPHDILSGAACPILPSNKEKAEIFVMASEA
QRAVNTCTALRRWGFSSVSVVSVDAVSAVIAVAQKSAGTAKTSSTEN
Download sequence
Identical sequences A4H3S5
psu|LbrM04_V2.0090 XP_001561694.1.15230 gi|154331754|ref|XP_001561694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]