SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM05_V2.0950 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM05_V2.0950
Domain Number 1 Region: 8-128
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.27e-25
Family Multidomain sulfurtransferase (rhodanese) 0.000000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM05_V2.0950
Sequence length 128
Comment | organism=Leishmania_braziliensis | product=mercaptopyruvate sulfurtransferase | location=Lbr.chr5:351362-351746(+) | length=128
Sequence
MSAPAAAPKHPGKVFLDPSEVKDHLSEYRIVDCRCSLKIKNHGSIEYAKEHLKGAIRADV
DTNLSKFVPGSTARHPLPPCSEFIDWCMANGMAGELPVLCYDDECGAMGGCRLWWMLNSL
GAEAYVIN
Download sequence
Identical sequences gi|154332185|ref|XP_001561909.1| psu|LbrM05_V2.0950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]