SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LbrM05_V2.0970 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM05_V2.0970
Domain Number 1 Region: 302-367
Classification Level Classification E-value
Superfamily FKBP-like 4.32e-34
Family 3-mercaptopyruvate sulfurtransferase, C-terminal domain 0.0000301
Further Details:      
 
Domain Number 2 Region: 8-158
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.31e-32
Family Multidomain sulfurtransferase (rhodanese) 0.000000149
Further Details:      
 
Domain Number 3 Region: 174-294
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 6.94e-22
Family Multidomain sulfurtransferase (rhodanese) 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM05_V2.0970
Sequence length 370
Comment | organism=Leishmania_braziliensis | product=mercaptopyruvate sulfurtransferase | location=Lbr.chr5:357771-358883(-) | length=370
Sequence
MSAPAAAPKHPGKVFLDPSEVKDHLSEYRIVDCRCSLKIKNHGSIEYAKEHLKGAIRADV
DTNLSKFVPGSTARHPLPPCSEFIDWCMANGMAGELPVLCYDDECGAMGGCRLWWMLNSL
GAEAYVINGGIQACRAAGLEMESGEPSSPPTPAAHWPYKTDFQHHYLMHEIPLNAIITDA
RPADRFSTTVRPYALDKLPGHIEGARNLPYTSQLVMRGGGKVLRSEEEIRHNIMTAIQGA
CDTTDLSSCVFSCGSGVTACMNIALAHHLGLGHPYLYCGSWSEYSGLFRPAIVRRVINDH
GMCMQMQTPALGDNPKANLDTMTLKVDGAPCKSPDAEVRSAAVHLHSGEAATVYFKSGRV
AMIEVPPPSN
Download sequence
Identical sequences A4H4E2
gi|154332189|ref|XP_001561911.1| XP_001561911.1.15230 psu|LbrM05_V2.0970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]