SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM08_V2.0800 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM08_V2.0800
Domain Number 1 Region: 1024-1262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.85e-23
Family Extended AAA-ATPase domain 0.064
Further Details:      
 
Domain Number 2 Region: 622-738,778-914
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000231
Family Shikimate kinase (AroK) 0.051
Further Details:      
 
Domain Number 3 Region: 2202-2386
Classification Level Classification E-value
Superfamily vWA-like 0.000000000252
Family RoRNP C-terminal domain-like 0.076
Further Details:      
 
Domain Number 4 Region: 25-141,193-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000872
Family Nucleotide and nucleoside kinases 0.088
Further Details:      
 
Weak hits

Sequence:  psu|LbrM08_V2.0800
Domain Number - Region: 1903-1985
Classification Level Classification E-value
Superfamily NHL repeat 0.00915
Family NHL repeat 0.049
Further Details:      
 
Domain Number - Region: 152-196
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0556
Family Ribosomal protein L29 (L29p) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM08_V2.0800
Sequence length 2392
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr8:313299-320477(-) | length=2392
Sequence
MGPTGGLPSLNGGTVTEENMFFTLQDPLTRSYLRWIAQKEQLGQDMCLIGDPGPAMRWLV
MLYSHLTRREIRVVYLNSDITESDLKQRREIRNGNLIYDDQSAVSAAVEGQLLVLEGLTR
VERNVLPVINNLLENREMHLDNGSVLIHPARYDSLLQKLYESKLQQRGHQQQSASDGLRN
VELIAEAKRELAQMGLVRVSERFRVIGITVPVPPYEGNPLDPPLRSRFQCLYVRTPMPVV
APSSSVVSALVARADGTSRNNHKRIKQVAELQEQHSDRFARVVQLRAAITAINDSTSDFQ
LSKPSKKKVTSTAPVHGRGRAPRTPMYYRGGMVEQLSEDDADTAAGVDNADSGVAAASSP
LQALDNWALATIAQQLALFPDTPVGEVVIRGFPWPYYARQLTRSGAGGAATGYANVEEYH
RRLAQYAEVLQHCRVYPPLLLAANLTDSNTHARRSSREDSGLNRLHGHQVHEPPAKRLRM
SERLRTLVQGQDEPGDDEPRGAAAARAYVRSAQLVSAPSRVVSVPLPVQQIYNYILQYRN
VTSTAVFSGVPVVVADAVVATAAHNAEHPGQPGTYLLKVFMGPRALCSRGSSDASGYVGW
DVAEYLSTTAAPSTVFTTEHYHVLQAMLQVHASRQHICLLGPTGCGKTAMVRAFGRLLGY
TLAPTMHLYADMTHKDLFQQRMTDPKTGNTTWQDSPLLRAAIYGELVVLDGMEKLPSGML
SSLQQIVVDQSAVLADGTMLKSAMEYNRLKERLTERDPITGVVVRKPTDEDMRERRIFPV
HPCFRVVATARPPQPVSGGGGGAAGSRGGRDFFITQDLTTLFRMVAMPDAGEDALGPVLR
QVAQTEARLLQAETWRKQEAPAATQQRIEVVVEQLIQLRNGLAELHSTDGKMPQLSLRQL
RQLVRSAVRYPSRIEESVCNTLLLPLMTGVAATKVRHALETSGLVHSSTRTATGRGDTTS
TEPTAEGEVLLVAPNDGVHAGGEASTSPSRLWSVNGEPVLQLSRVYTQAELALVPYVTGF
HANRVHESILAWLAKQYAMGSNILLIGNQGVGKNKVVDAFLSRLGIPRHYIQLHRDTTVG
SLTINPTVEAGKVVWEDSPLVKAVQRGHCLVVDEIDKAPVEVVQVLKGLIEDREMRLGDG
RQIYDPAMEPYTSSAAGTMQRIAIHPDFRIIVLANPPGFPFHGNDFFRECGDLFAAYVMS
NPDAESQLCVLAAYAPTLPRPLLKRLVLVFLELQNAFTQGNLTYPFSLRELIAVVKHMSC
YPQDGVYEALNNVFNFDARDENTLRVVRQVLANYLQPMIQQGGLQRLKPYKAGQPIALLP
FKELVTLPMTTMATTATAADAGHFTTLVFLPAEVTLSEHRFLSRIMETEEERAASQGQGS
RTSDTGAAAWHVTYPTEAFFPASPAADATLSTTEAFTEWASQSALPFVNSNTDTVVAMTS
VAAVGGTDAATEAATLPLLSVLLLRRTSAKDGSSWKSEPSATAAALRLIVATVRLPPSSI
EVRYLFADKAEELATLWPVGHARFVDVSSPYATELADAAECLSSLFTFTGLDMSTQALPW
RTGCGEAGDAVGQQQHLRIWPPSLATWSHTMGGRTSLLRKRDGTGLDGERTPQGVVLLSS
NKTGRTVLIDVLAGAASDLYMARMGLAKGATTSASNTACAATTTSLEPVLPLHLDRCLSA
ASATSAAQASVRVLDVSARHGVICFAAASSATKECFFLLQGRVVRVSFPQPVVSLRFVGS
RLATVEMEAPAAGDAREMSRRRAHRSTGVVKVSVAADGRAHATMLPLSPDTQRLELVDAP
AIAAADDGPTAHLSASDRSSASHDVLVPEDLKGSLWRVAAATASSSASTSPSADGTSDTY
KDDPVGRNVVYARVEGTAESGLQLRYYKSKTGPTSASAVPLVPTVLVDDARHQLLHIHSD
GRTVSAIDTQHATQRTFASVPEAAIQAASTSPSAAAAAATADLWSLDNHSGTVYVWKPAS
QQVSVADVNGERVRQRYSEWSSLLTGNAATVGDAATVEEDEVGVKDFKMKYSTPRKQPSG
TLKHGEIDDKEHHGGNTWAGGTGGTDTAGLGGLVGPYRLDKGNPVHQVSPEEKRKVPKHL
LEEARRMGRNALKERLQSIGMSEEEYEEYKGLQERVQPAVAQLRALLMGLKAAEGERVWM
TGQTDGVWDDKKLVEGIVGEANVYKRRVDSKETSPFQQKYKKRLVFVLDVSASMYRFNSM
DQRLTKLLETTIMIMEAFAGFEAKLDYAMIGHNGDSDNIPLVSFSSPPANQKERMIICQK
MLAYAQYCWSGDNTVEAMRRSIELVTKEKGDSYFVFVISDANLRQYGITPRELAEIIQSK
PEVKMFCIFIATLGAQASHLQQQLPAGHGYECMRTDVLPQVLRQIFTSANLF
Download sequence
Identical sequences A4H5E3
XP_001562138.1.15230 psu|LbrM08_V2.0800 gi|154332643|ref|XP_001562138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]