SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LbrM09_V2.0170 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM09_V2.0170
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000202
Family GABARAP-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM09_V2.0170
Sequence length 124
Comment | organism=Leishmania_braziliensis | product=ATG8/AUT7/APG8/PAZ2, putative | location=Lbr.chr9:64304-64678(+) | length=124
Sequence
MSAYVSSTPLEARVARCASLRATNAVPVVVEEAQARGGKAHFSALARETTAAQLVAAVRA
FRGVAANKPVTLTVAGCSVSPSATLGELHDACKQADDGMLYVAYTAERSMGAATWKPCGS
CSWD
Download sequence
Identical sequences A4H5J2
psu|LbrM09_V2.0170 gi|154332742|ref|XP_001562633.1| XP_001562633.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]