SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM09_V2.1510 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM09_V2.1510
Domain Number 1 Region: 8-121
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000343
Family Multidomain sulfurtransferase (rhodanese) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM09_V2.1510
Sequence length 131
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr9:530639-531034(-) | length=131
Sequence
MSLPDFTHPFNVYEAQAVVRALEAGRTSGVYLLDVREEFEVKAVPPLPHALVIHFRDLHT
AMRMWASSFQSKYGVRKPRKKDRILVYALNQQRAASGASYLVERGYKSAVFLNAKISEYL
DSTQNELDEDL
Download sequence
Identical sequences A4H5X2
psu|LbrM09_V2.1510 XP_001562763.1.15230 gi|154333002|ref|XP_001562763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]