SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM09_V2.1520 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM09_V2.1520
Domain Number 1 Region: 11-138
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.31e-21
Family Multidomain sulfurtransferase (rhodanese) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM09_V2.1520
Sequence length 150
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr9:531704-532156(-) | length=150
Sequence
MLRGTRYLCRYFTIDQVANIVKAKQSCSDAVRNIQLIDVRSTAEVAATGMIPSAINVPLP
VLSDALSPESIIEDDEFEFFFGGPRPVQGVTQLVLYCAHGVRSAIACEVAEELGFENAGN
FSGSWAQWYHAYGTPSTSAAPPESSPTPLQ
Download sequence
Identical sequences A4H5X3
XP_001562764.1.15230 gi|154333004|ref|XP_001562764.1| psu|LbrM09_V2.1520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]