SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM09_V2.1530 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM09_V2.1530
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.62e-25
Family Multidomain sulfurtransferase (rhodanese) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM09_V2.1530
Sequence length 119
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr9:533111-533470(-) | length=119
Sequence
MQRLTYAAMKALVAKKQSGDRHMCILDVRSADEVAGGAIAASVNIPLDQLESALQLTADE
FKEKYKAPKPETSDHVVTYCLRGMRAESAAALLRSSGFTNVDVYPGSWTEWSEKEKSAA
Download sequence
Identical sequences A4H5X4
gi|154333006|ref|XP_001562765.1| XP_001562765.1.15230 psu|LbrM09_V2.1530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]