SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM12_V2.0300 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM12_V2.0300
Domain Number 1 Region: 230-479
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.18e-62
Family Alanine racemase-like, N-terminal domain 0.00000127
Further Details:      
 
Domain Number 2 Region: 447-625
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.05e-37
Family Eukaryotic ODC-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM12_V2.0300
Sequence length 636
Comment | organism=Leishmania_braziliensis | product=ornithine decarboxylase, putative | location=Lbr.chr12:104342-106252(+) | length=636
Sequence
MMKMVPPVSVLDVDAVPDRLHTCKRRLLEQYHIDSRSTTLNPLSRANTTAGRNEAAQLSD
VDAQQPILPTECNKQTPEYVQEVALGAAADSTVNQHTAVAASQDIVDLFFLEGSQAVNGL
CFSPYPTYGWRTAEERRAAIYAVFKKYNVATHLPASPAALAAAQHHHSHHQHASIHAINK
MAIETREQYWRRLSNVYIEKGVKAAAATAAATTTPTNCTISGVPRHEPEDPFYIIDLGRV
VEQMARWRHELPMVRPYFAVKSNPQLALLEVLGALGSGFDCASKGEIQTVLDNHLVASPD
DIIFANPCKQPGDMREAQARGVTYVTVDNLLEIEKISRLMPSARAVIRIKTNDSKAKCAF
STKFGVPLNDVESLLQAARQFKVDVYGVSFHVGSSNSDPATYVSAVRDAYHVFQQASQYG
FNCTLLDIGGGFPSVETNTASGEATFEDIARAIRPVLEELFGGGDVTIISEPGRYFTAST
HALLVNVFASRKLRMSDVEKASSQALQSVVPMDEPEEYQYYVNDGLYHSFNCIIFDHAHP
TLLLLNDGDGADAVEGNKEEGETSLSSRTRRPLRITTIFGPTCDSLDCILRKQPFPEMKL
GDWILVPDMGSYTTAAAAPFNGFSTHRFEWVSSIAL
Download sequence
Identical sequences gi|154333647|ref|XP_001563080.1| psu|LbrM12_V2.0300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]