SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM13_V2.0320 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM13_V2.0320
Domain Number 1 Region: 1336-1545
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.54e-49
Family Tandem AAA-ATPase domain 0.00043
Further Details:      
 
Domain Number 2 Region: 1044-1326
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.33e-45
Family Tandem AAA-ATPase domain 0.00032
Further Details:      
 
Domain Number 3 Region: 264-469
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.73e-45
Family Tandem AAA-ATPase domain 0.00041
Further Details:      
 
Domain Number 4 Region: 1671-1808
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 6.02e-43
Family Sec63 N-terminal domain 0.00027
Further Details:      
 
Domain Number 5 Region: 475-690
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.92e-42
Family Tandem AAA-ATPase domain 0.0009
Further Details:      
 
Domain Number 6 Region: 819-1005
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.86e-37
Family Sec63 N-terminal domain 0.0048
Further Details:      
 
Domain Number 7 Region: 1885-1982
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000308
Family Sec63 C-terminal domain-like 0.002
Further Details:      
 
Domain Number 8 Region: 1545-1653
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000109
Family RecQ helicase DNA-binding domain-like 0.035
Further Details:      
 
Domain Number 9 Region: 690-795
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000544
Family RecQ helicase DNA-binding domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM13_V2.0320
Sequence length 1986
Comment | organism=Leishmania_braziliensis | product=RNA helicase, putative | location=Lbr.chr13:116656-122616(+) | length=1986
Sequence
MTQGHLAEYIFTGGVQTNSFVSECMQAQRPVALLTHSGEPLSPRGDRVGGSGRSAYQEQR
KISLDMLLSSVDDIVSQVYVNFDEDLTKLLLNALDRVTACETLDQKERAKVRVIDELLEV
LGDSHYDLLQCIMYRPREVFLRLLEEFCTLEDAGDAGVSQSSGGPKGLTVRVVKNTNQRS
QGQDVVINDAGKLTDQKWLAHMNKRYRVLMQESELDELFKRDFSVTGSIMPAGATVTKKS
GHVRIHIPPPTQEILPDSKRICIATSLPEWTHPAFLSITHLNTIQTTIFETAFHTSQNML
VCAPTGAGKTVCALLVMLRCISEHFEGGVLDRDFKIIFVAPMKALAQEMVENFSRRLAPF
MMKVRELTGDMQLTKRELAETQVIVTTPEKWDVITRKQSNEELVSQVRLIIMDEIHLLNE
ERGPVLEALVARTLRHGELNPEQRIRLVGLSATLPNYKDVANFLQADLREGLKVFGPEYR
PVPLEQTFIGVQNASGPQKRNKEFELDRLAYEEVVKNVREGHQVMVFVHSRKQTIGLAKY
FIEESKCRGEEQLFQYRGVMPSAIDKKGRTLQGRDLASLFIAGFGAHHAGLVRYDRTSTE
GFFRDGYLKVLCCTSTLAWGVNLPAHTVVIRGTQMYDPKRGGLVSISVLDVMQIFGRAGR
PQFDTSGHGIIISDDKEVSHFLRLIAHALPIESQLQGKLCDHLNAEVNAGTISSVMEASS
WLEYTYMWQRIRVNPLTYGLKVNNVRKDPELKAVRYGMINTSFTDLAIAGMVRYNPETGS
VESTDLGRLASHYYITYESISIFNEKMRRPDDTWIDTLDMGTAMNIAASAKEFSQLKVRQ
EELDELQYLHQLLPKQVREYRVSDESADETSTQWKVTTLLKAYINRLSVETHSLSSDMVY
VLQNMPRICRALFEIELERGHPLTTYTYLTLCKCIEHRCWDFEHPLMQFANWSHRVNITD
AVWMNLNKRNPSMQLLQEMTAKEAGEMVHNVRAGRDIVDLVSKFPSVNIDIDVQPITRSI
LRVKVTIEANFVWSRDLSGNSELFWLLVEDQDNHFIFHHESVTLTRKEVESGTPHVVNLA
VPIVPQYDMYSVRLYSDRWMGCKEDYTFSIGHLHLPEDSQMTTKLLPLGPLRLHVIPEEY
HVMYSNYRQFNAVQTQIFHAMFHTDQNVFLGAPTGSGKTIAAEMAILRVFEQYPGKKVVY
IAPLKALVKERLRDWKARMTLVGRSVVELSGDATPDISALAKADILCTTPEKWDGISRNW
QVRSYVTAVKLVVFDEVHMLGTDRGPILEVIVSRMRYIGWSLKAPIRLVGLSTAVSNPGD
LSSWLGVEKKWAVFNFDPSVRPVPMTVHIAGYHGKNYCPRMATMNKPTYNAICEKSPTQP
VLVFVSSRRQTRLTAMALIGFLLMEDNTAKWVHMDVDQVQKYTSRLDDPYVKHCLQFGVG
IHHAGLLEGDRTIVEEAFLSNRIQVLVATSTLAWGVNLPAHMVVVKGTEYFDAKTNSYVD
FPITDVLQMIGRAGRPQFDTEGVAQVLCHEPKKGFYRKFLYDPFPVESALHKQLHVHINA
EIVSGTINTRQDAVNYLTWTYLFRRIARNPSYYGLEDGSPKAVTIFLSTLVKGVLADLER
CGCIEQPDAMDEDFDPDAIQYTILGKLCSYYYISHITVDLFNRSIEPDHSCGELLRLMCD
AEEFNELPVRHNEDKLNMQLARQLPLPVRDAEVDSPHAKAFLLFQALFERAPMPITDYIT
DQKSAMDNAVRVIQAMVDVAANNGHLYAALRCMALMQCMVQARWWDDNSLLQIPNVDKAM
LPVIEKECDGVRGAAELANRPLAVLHSFQKVLEMPIFGLQERDVNESMEAVRGLPLIQVD
LTIQQQQPTAAEETSANDEEAVLTYELTVHLQRLSFGQKSVIAPHFSKAKDEQYWVVVGH
EPTGELVALKRVNRLRQSSTTTLQIEWDEDWVQYNPDGTVELNMYLVCDSYIGMDQQYSF
ILPRSN
Download sequence
Identical sequences A4H739
XP_001563175.1.15230 psu|LbrM13_V2.0320 gi|154333840|ref|XP_001563175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]