SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM14_V2.1240 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM14_V2.1240
Domain Number 1 Region: 23-132,175-210
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.58e-37
Family Vacuolar sorting protein domain 0.0049
Further Details:      
 
Domain Number 2 Region: 293-337
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000256
Family Vacuolar sorting protein domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM14_V2.1240
Sequence length 399
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr14:499282-500481(+) | length=399
Sequence
MRRRVGVGHVLQERQQQQRMADLGAQITAERVGQIEDQLEELQAQLKTLAQNHKSDITED
PVVRARFRQLADSLGVDLLSSKKNVFADALGLGNFYYQLASRTVEACMRERKFCGAYVPL
QRVQFFVQKTYDNSSLLCGNGQSRHVSPHRGGSSGSSSGGGGKRGGRDEGKRIVISEADI
LTALSKLSVLGVGFNVVKLGGIPYIQTTPDGARGGDQVLLLNYVLGLQKEQIEKAKRTAV
QEQSKSMPTSSVNNSWTTAEGGSNQRNGVGAVYALGAHPFAFEKDKSSQANDALSFAQQC
VAVRESEIVSGLHWEAHRARAALRRMVQEGTAWVEESQDRPGDRATKTGAQGDSPEKSKA
VLSSFEEVKVVWKGKHKGTTETADKDDVVYWFVSLTSHA
Download sequence
Identical sequences A4H7S7
gi|154334317|ref|XP_001563410.1| XP_001563410.1.15230 psu|LbrM14_V2.1240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]