SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM15_V2.0300 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM15_V2.0300
Domain Number 1 Region: 10-88
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000206
Family Single strand DNA-binding domain, SSB 0.0033
Further Details:      
 
Weak hits

Sequence:  psu|LbrM15_V2.0300
Domain Number - Region: 125-179
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0245
Family C-terminal domain of RPA32 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM15_V2.0300
Sequence length 183
Comment | organism=Leishmania_braziliensis | product=replication Factor A 28 kDa subunit, putative | location=Lbr.chr15:108980-109531(+) | length=183
Sequence
MASGGGAITAKHFGYRITDNTGMLVVRQWIDADRVQEPIPLNAHVRASGTVNVWQQTPIV
TGTVVSMADSNEMNYHMLDAILTHFRLTQGNKRTQHSGASVQNTASAVGMHNMLPGGDNK
VLLTDLLVSFIKQHGSGGAGMSMDELTMAAQRYSFTHGDVRTAMRTLAAEGKVYQTHDNR
FNI
Download sequence
Identical sequences A4H800
gi|154334464|ref|XP_001563479.1| XP_001563479.1.15230 psu|LbrM15_V2.0300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]