SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM16_V2.0620 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM16_V2.0620
Domain Number 1 Region: 131-213,299-415,490-521,587-651
Classification Level Classification E-value
Superfamily DNA topoisomerase IV, alpha subunit 1.2e-54
Family DNA topoisomerase IV, alpha subunit 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM16_V2.0620
Sequence length 653
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr16:221372-223333(-) | length=653
Sequence
MTDTFVEVSPAVVAVNEAEALRDEALRRMEVYVLGLLHTLLWLPVKGVSLSGTTMLAFEG
GTFSSWRRHSQCAVPCELQASTRRECGATSAPPVSLPSEERAGAKAPALGYGGAPTRPND
GQPVASMRALQRARHHLLLLTVLFRNVVRGDVTTQRDVYYHLVRHIPTQVVVNRTVKQLS
RVLRLPRQLMGVTAGGRGYIAGWLSYRGVSLQGGGPGAAAEEGMPLPLLSTDLVVSVQEI
AECTAAENEEEHGFSVLLSSPISMLRSRSPQQSASSRLTAAQHRDLTSCSATDAAATGFQ
VSPAVCAILVVEKHAVFAQLLREGLPRLLPCVLLTSQGFPTYAARQLLAHLHTALPRAPV
IGLVDYNPHGLAILAAYRWATASDALTAGSASMERHYYVVPNLRWLGVRTAHVSRVMEKT
ASDNASTGGPSVEQCPRLHHYTPAPLQTSVRPWKGTGTGSRSHDNDGAVASASSCASYAP
HTAENAAMASPLSSIAPLQHFTRRDAVVMTHQIERLEALLHLTASPPAAGEGLGTAVEVD
EERNHNFVERPHVKRVARISVDLAAVHQRYNRLSVAGLAHQADRASVVAWLNEAREMQRR
SVKCEMEALYTVPYSHHFLGSASVVHAQRRGVHPAPSQFAEWVCQQILRRQYI
Download sequence
Identical sequences A4H8I5
gi|154334835|ref|XP_001563664.1| psu|LbrM16_V2.0620 XP_001563664.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]