SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM17_V2.0940 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM17_V2.0940
Domain Number 1 Region: 489-661,690-744,786-883
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-44
Family Tandem AAA-ATPase domain 0.001
Further Details:      
 
Domain Number 2 Region: 1016-1194
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.83e-31
Family Sec63 N-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1337-1394,1424-1568
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000143
Family Tandem AAA-ATPase domain 0.01
Further Details:      
 
Domain Number 4 Region: 1983-2024,2077-2157
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.000000706
Family Sec63 N-terminal domain 0.019
Further Details:      
 
Weak hits

Sequence:  psu|LbrM17_V2.0940
Domain Number - Region: 897-1000
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000653
Family Hypothetical protein PH1932 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM17_V2.0940
Sequence length 2365
Comment | organism=Leishmania_braziliensis | product=ATP-dependent RNA helicase, putative | location=Lbr.chr17:406373-413470(+) | length=2365
Sequence
MSYVSLLERSLATHYVPHSDLTKSYYERLLLDVRRHLPPGVEDDVEEIAEQVLSIVCSAA
SGTSSSAATLSDQQQSLERLLDTRLSREVRDHFLQYGKLITDYVADDKVAANGTCGLLTS
SSGALGVQDLNFAGPSSSDTDSDGSSDTLRSDAEERRKVELLTGGASSSAAERKERRKKR
KALMKDDQNLMQYAFAEGGGIADTVEEAEAWGASATLAAGRGASGELNDDEYDEDDALAA
RAVEMPRIPFEEVACNAQFLKDAVRRLFPAHDADTCNRLAQRVLNFLSEKEEDDFTLETQ
LTTCLGGYEDEAVMDWIGDAVQSRWSVVYGLRYAQCTTQKERHVVMDGMRQHALDDPRVE
HLYQSITGKEVDPLNMEQLKQHREFAAAGGNEEAVSTLASAAPRQHVLRRVNLQACAFQD
ERAPHLHVRATVPQGTQRLTYETHDEILLPPSSSCSASDPLIPVATSFPGWAVPAFPGVV
ELNAMQSKVYDCAFHSDENMLVSAPTGAGKTNVAMMAMLRAIAAARNTATGVIDGHSLKM
VYVAPMKALVQEVVRTFSTRLEPLGLTVAELSGDMAMTQQQMAATQLIVATPEKWDVVTR
KSVELGVASLLKLLIIDEVHLLHNERGPVVEAIVARTMLQQQLRGEGGIRLIGLSATLPN
YTDVAAFLQVNRQRGLFVFDNSYRPIPLVQAYCAIKKVKGMAQSAVMNLVAYDKVLHAVQ
AEEQVMIFVHSRGETEHTARCLQKRVAEERRGYYFVRPDGDSHKALLEASSGAGGAVLRR
SLQKFLPDGFGIHHAGLSRDERNTVERLFADRHIKVLVCTSTLAWGVNLPANHVIIKGTR
VFNGARGRSELLSALDVLQMFGRAGRVGYGATVGRATIITSPDDLHYYLSVLNQQLPIES
HMMRRLVDMLNAEITLGHVETVDEGVQWLQRSYLYVRMQQVPEVYGIRASSSDPLLLHHL
ANIVHTAFEELKESKMADYDARARTVVGTAYGRIASYCYITTASMAAYLGLMSNAMQDVE
LFRVFASSSEFASIGVRAEEQAQLKELMESAPVAVRESRYTPLAKINILLQCYISQKGLE
GLPLMSEMAYVKDSAQRILRALYEICLVREYGRTARQFLELYLMTVHRQWAVQSPLRQVR
DYLPVKNFDAILPALERVRVPWEEVRRWSVEDLAEKLSDDRRAQSAYEAIHVVPHYAVDA
AVRPLTRGMLYVDVDILPDFDYVESLHGCSVCEVELMIEHTNGRLLHHELMLIPLANVLE
QVAYACPPVVVPMVEPAPTHLLVRVASPHWLAATASASVCLLNTLLPPVAAPLREVDQRP
PSQDANITSVAERLAPFQLHTLGETLFPFQDFTALQSDLIDPIFLDHPHNLLVGVPPGGG
KTAIAELFVLQFLLEEALKETERTAKTHQQEEEERPATRSKLLLPGKLLYLTSNPDVVHR
RALNWRYKFGEVLKQRVVELAGSWGGDTENDGAEEISNAAEVTSAAIVLATGANLIRLVR
RGDPVLAGVTHIIVDHLHLLRAPEGQAMEECMARLNSEPFLVRCGAGRARVLGLTYPLIS
MAELGRWLKVSVNHQYNYGASYRQLRVRMAGMELPGPQSRYESGVIAALKLLRRPSYAAA
PTVIFVPTARQAREVAQRILLRCRDNYIPETTEHATDDARLAVFLAAGVAYMHKGTSELD
ALAIQELVDAPAVYPTTQALLPLRLVCTFDAAWRLPAALFTNAIVCCGERLTAFEREDGE
RGMRYQDCSAAELMQMASRAMNEAVLCVRTPRVWVWGKLLNEPLPLESSLRYADDFRDTV
NTAIAQGRAHNRVDVLRVLSSHYFLYHVKSNLHFYGVPTAADVSLYASSFASHVVTSLKE
LKCIEELRVRRHHADSDDDAGEDGGNKSNAEFEDTEEDEDPHAPLRPTARGMALAHHCIA
VSTAEDLVRVLPASLEAEKKAALYDSTTYLWQILAHHCVELTPAHLGDAARVTEAAEYRA
LHSIARALPESIGVRYIDLDFGAAGTKVYLLVLAYCSRLFPATYFHPAGTTSSIEVDTVA
AAAFDTHFGHSLYHAAVPAATRDALCNAVPDDIAQRLVQDARFLLPAVRRVVTAVVELLD
GDAQEWAVARLIRFGACLQQQGWDGEAPVTQLPCWRALRWSSFAARQVIQSSCTLQELQT
NPTGAASKLEPALRGVVTTDDAAVVVQHVLASAVQDAAGVPQVVSISAKGRVEEVNGVLA
MVVRVTAQLRWKAPTMLRLAEGSGGVDCTLQGGIVGIADDVAPTLKWWVRCIVSNRSLAA
SRAGASAGTRQLALRVSVARNVMDAEATSKYEVSSDVLFSLARLEAEDLDTVEMRAVVTS
MAYCGVEATTAVRFDVDEDENGEDK
Download sequence
Identical sequences psu|LbrM17_V2.0940 gi|154335242|ref|XP_001563861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]