SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM18_V2.0760 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM18_V2.0760
Domain Number 1 Region: 25-465
Classification Level Classification E-value
Superfamily Citrate synthase 4.58e-125
Family Citrate synthase 0.000000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM18_V2.0760
Sequence length 470
Comment | organism=Leishmania_braziliensis | product=citrate synthase, putative | location=Lbr.chr18:291615-293027(+) | length=470
Sequence
MRAARCSIIRGAAGLRMASSVMSEMKEQMLKRSKVEKQTISELRKKHGDVKLSDASIDAA
YCGMRGITGLVYEPSLLDPVEGIRFRNRTIPECQEVLPKAPNGCETLPEAMFWLLMTGEV
PTAEQARALNAELHRRADPVAIAAAQKAIAALPASTHPMTAFSVGVLALQTYSKFAAAYA
TGKSNKTTYWEYALEDSLDMLARTPAVAAMIYNRVTKGRAEVAASSNSELDWAANFSNML
GFKDNEFWECMRLYLSIHVDHEGGNVSAHTTTLVASALSDPYLAFSAGLNGLAGPLHGLA
NQEVLKYLLSMQDRVKADGVNVCDEAALEVALTKYTWELLNSGQVVPGYGHAVLRKVDPR
YTCLRNFCLRHHFEDDLFKLINIIYKIMPGILTEHGKTKNPYPNVDAHSGVLLQHYGLTE
QDYYTVLFGLSRQMGVMAGVVWDRLQGRPLERPKSITTEMLAKKYLCTPR
Download sequence
Identical sequences A4H9H8
gi|154335523|ref|XP_001564000.1| XP_001564000.1.15230 psu|LbrM18_V2.0760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]