SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM19_V2.0470 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM19_V2.0470
Domain Number 1 Region: 19-251,322-348
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 2.75e-49
Family Creatinase/aminopeptidase 0.0005
Further Details:      
 
Domain Number 2 Region: 250-323
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000667
Family Methionine aminopeptidase, insert domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM19_V2.0470
Sequence length 380
Comment | organism=Leishmania_braziliensis | product=aminopeptidase, putative,metallo-peptidase, Clan MG, Family M24 | location=Lbr.chr19:124482-125624(-) | length=380
Sequence
MSKNVDQGEWEDCGDEEAQEEGEEDTTINNSNVVVRHKKAAVWCNETLRLLIDATKPGAK
VCDLCRLGDDTIAAKVKTMFKGTEKGIAFPTCISVNSCVCHNSPGASDEATQQEISMGDV
VHYDLGIHVDGYCAVVAHTIQVTEDNELGKDEKAARVITAAYNILNTALRQMRPGSTIYQ
VTDVIEKAAEHYKVTPADGVLSHMMKRYIIDGYRCIPQRRVAEHMVHDYDLEKAQVWTLD
IVMSSGRGKLKERDVRPCVFKVALDSNYSVKMESAKEVQKEIDSKYATFPFAIRNLESKK
ARLGLNEMSKHGAVIPYPVLFEKEGEVVAHFKITLLISNKKIEPITGLKPQKAPALESYT
DEMLLATNKLSLSLEKRATK
Download sequence
Identical sequences A4H9X3
psu|LbrM19_V2.0470 gi|154335814|ref|XP_001564143.1| XP_001564143.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]