SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM19_V2.1050 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM19_V2.1050
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-23
Family VPS36 N-terminal domain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 263-346
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.26e-18
Family Vacuolar sorting protein domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM19_V2.1050
Sequence length 466
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr19:404103-405503(+) | length=466
Sequence
MDYWKLNTDGTGLEVDEVCILSQHGVTLYNGDEKTHRRNGKLALTTHQLRYNDEADVSTV
LQLPLELVRRSGRAPSLSSGFGPFSSPKIVVPLPQNAYVKLSFRAGGVEKFYTAFVDALE
KKAWLQAAATHSQAQPPQGAVVGKSLSTPASAVNGGGSSSGASPGTTTAVPSTSPPPPVP
RGVGIAGVQLASAQSAAMNETLKDIDDIMNKASTLVSNIRRLRERNEAAAVAGSNPGSET
AVERTKIESIESTLGLGTMVTRYGTNCSDSRFHKDLAVELHAWMTHESNSRLFNDMPVVP
LIELFALYNKARGGDLVSPLDVLNACKYMTTKVSGSCYDLVTLLSGRKALVNRNDSLLLA
KLTTLLGPQLVNPSGSPVQDAWKKTSPHSQQCGEGASPLVRIATTSDFPKASRELKFVSD
VSLAEKMQVATEVAADILALLLLKGFLCCVDTGFDCYVYTWNIFVF
Download sequence
Identical sequences A4HA31
psu|LbrM19_V2.1050 XP_001564201.1.15230 gi|154335930|ref|XP_001564201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]