SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LbrM19_V2.1140 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM19_V2.1140
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 3e-20
Family GABARAP-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM19_V2.1140
Sequence length 136
Comment | organism=Leishmania_braziliensis | product=ATG8/AUT7/APG8/PAZ2, putative | location=Lbr.chr19:428436-428846(+) | length=136
Sequence
MSVYRSLISADARRAECERVCREHPEQVPVVVESANSSHIRFLAMPRDAMVADLEATVRQ
TLGATSKKVALAIEGCSPAAMTMVGDIFDAYKQPDGFLYVSCARESAMGAKDVCCVGDTG
KFFEDIENNPNLLGSM
Download sequence
Identical sequences A4HA39
psu|LbrM19_V2.1140 gi|154335946|ref|XP_001564209.1| XP_001564209.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]