SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM19_V2.1440 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LbrM19_V2.1440
Domain Number - Region: 299-374
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00132
Family PCI domain (PINT motif) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM19_V2.1440
Sequence length 412
Comment | organism=Leishmania_braziliensis | product=proteasome regulatory non-ATP-ase subunit, putative | location=Lbr.chr19:562869-564107(+) | length=412
Sequence
MSTPEARAQVYLVNLREKLEANNNASAAATVSRALDYFEQRFWYELSSELLQLIRDPMVL
EDAHELYTDVIVAVRADISPIAYIMIVRSVCFAPHSTTQNALELVEGACASLIHSSSEQG
HYAALCIRALLLLESTSAEESAALAAVPGSPPHTARKLLEQTETYLHGLKMHEVEPVLVA
LYGMARGRDYEIRRQHTSYYKNSFDIIIFLEKADLPMRDEDVTTLAYKTVVAGLLSDKIF
NFGKLLNFDQFVSRLQRESCPQHWALKMMQLCNDGDVVSFEAFFRQHQLQISQEPQLVSA
SATLHRKVRLMALLHLIFYTPLSERTFTFHAVAQRCGVPDSGAEPLLLEALAHGIIKGRM
DGLKEEVHITWVESRVLSLEEVKALAKHVAKWREQVVGLTESVKEMAKRIPQ
Download sequence
Identical sequences A4HA68
XP_001564238.1.15230 psu|LbrM19_V2.1440 gi|154336004|ref|XP_001564238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]