SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM19_V2.1650 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM19_V2.1650
Domain Number 1 Region: 49-179
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 4.18e-21
Family Cation efflux protein transmembrane domain-like 0.0091
Further Details:      
 
Domain Number 2 Region: 231-326
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 8.11e-17
Family Cation efflux protein transmembrane domain-like 0.006
Further Details:      
 
Weak hits

Sequence:  psu|LbrM19_V2.1650
Domain Number - Region: 395-448
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.0288
Family Cation efflux protein cytoplasmic domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM19_V2.1650
Sequence length 615
Comment | organism=Leishmania_braziliensis | product=cation transporter, putative | location=Lbr.chr19:652623-654470(+) | length=615
Sequence
MRRLFVMKSPAVAKTTAGAASTQLNTHSHSHSHSHGSIEKNISGKLLRQCQIATLAGGAT
NVFFCVTKLWIGSAGGSVALLADGFHSLTDILADIISYAAISLSRKRLPRCRFPLGIGRL
ETSGAVIVAAILFFGGVALLIQSLEQCFSELATLLGTAAPTRGIAAVFGISSHRAMAEAS
GKSTLASATAGHDHAHGSHIYSHAQSNGGGDHQGHSHFQVMQYDEGIGEQVILWTMVGIA
AGSVVCKELLFQWTRRVGLRAGSRVVLANAYHHRADAWSGGVALIGVAGQVMGLPGVDGF
AGLAVSLSICKMGYGIFKDAVLEFFDYQNAKEVCVIREQLQKFNLHIVRGVDVVPNYNSQ
DAAKAATSEAEASSANYTPTALSSDEDDTVHRRKIHFINVFLVRHGHQYAVHVTLLVHES
VSAQKIQEATDLITALARRSLPVQDTFTTLLLCSNYTESRDVSLCGCNNDAKGTDEEAAA
ATLSGASAGDHHHHHSHAGPSHSYSHTRGGDDNATSALPIAATGAIINPSLERCITSLQE
FHTFTAPIRYSWEERTITAPSSESCECERDISSVAEMFKCRLVGGGLISSRKAAEDLAER
SCHSHFHGAHPGHSH
Download sequence
Identical sequences A4HA88
XP_001564258.1.15230 gi|154336044|ref|XP_001564258.1| psu|LbrM19_V2.1650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]