SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM20_V2.2340 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM20_V2.2340
Domain Number 1 Region: 18-153
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.04e-44
Family Rps19E-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM20_V2.2340
Sequence length 160
Comment | organism=Leishmania_braziliensis | product=40S ribosomal protein S19 protein, putative | location=LbrM.chr20.1:982038-982520(+) | length=160
Sequence
MAALKNKIRRIGKRKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTELIKSSHGRERAP
QNPDWYYVRCAAVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHTVNSSTGPLHWACKSL
TKLGLVEPGAQSGQRLTRKGHKFADSLAFQVQIRKFGASK
Download sequence
Identical sequences A0A088S842 A4HAZ5
gi|154336559|ref|XP_001564515.1| psu|LbrM20_V2.2340 XP_001564515.1.15230 XP_010698453.1.42505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]