SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM20_V2.4750 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM20_V2.4750
Domain Number 1 Region: 204-282
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000412
Family Ribosomal protein S15 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM20_V2.4750
Sequence length 429
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=LbrM.chr20.2:126451-127740(+) | length=429
Sequence
MLSHTAVWLRVLSRKNKTPQRMSNFTKVTNLNKAKKAKIETIDGDVVKGRGRVHRRSHSG
LKDAIEAMEHPAIWLWYPWRKNPEPPTPYMPAQRALKNVHGAIFADLTPIQKKKQEQMLY
GVNIPETRVMRFEQQHPLLAMALKQLDGQPKGFPFWYKKYPTRRHAYEQRFSVPPEMLEG
YSDSIKKAFSKDMMTIQEKQFSQEAMYMERYAEHDFDTTSPAVLAVKRALKVRVLRNHLL
TNPHNNIVKTILANTERKLNHTLRRLRKVDFKRYWEIIRDHDVQDVLQPPNLVTYRQGSY
WRYDWNAGLAISTQLADVLDPRGLNGCVETGRSRSEVARDLGLSYTRPLQENEKKQLSEQ
AVYYERLAKFKMEQPEAARAQERERFVRKFSGMFLKLDIKSGVPDFPSTYRKLLGTQVAR
WSSKRHGPM
Download sequence
Identical sequences E9AIA8
XP_003723025.1.15230 psu|LbrM20_V2.4750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]