SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM21_V2.0600 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM21_V2.0600
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.54e-23
Family La domain 0.00018
Further Details:      
 
Domain Number 2 Region: 92-176,310-330
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000691
Family Canonical RBD 0.0083
Further Details:      
 
Weak hits

Sequence:  psu|LbrM21_V2.0600
Domain Number - Region: 247-294
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0473
Family Canonical RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM21_V2.0600
Sequence length 336
Comment | organism=Leishmania_braziliensis | product=la RNA binding protein, putative | location=Lbr.chr21:165391-166401(-) | length=336
Sequence
MSDLAAKICRQVEFYFSDVNVAKDVFLKSKMAEDPEGFISLEVLLTFNRLNSLTKDPKVV
AEALAGSDKLVMHTNGLSVRRKDSLPESIQTDEQTVYVKPLPALATLEQLQEFFSAHGTV
LAVWRRYFQGGNKDAPVESRTKPSVFVVFASKADAEKFVAAPPQYDGVQLSAQMKVAYLE
GKAAQVASQKNRKREREDGVDAGAPSSAAPRTPAMPTNSSYRISGCGAIEKFSEVKGLWP
AEEQKGVRYVYMPTKEEALIIFQDAETAEKMVASVKTRAATLQGKQPEVMKLTEEDEKAL
IANVEKEISERAAQHGSRGGRGGRGGRGGRRGGGRH
Download sequence
Identical sequences A4HBQ1
psu|LbrM21_V2.0600 gi|154337072|ref|XP_001564769.1| XP_001564769.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]