SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM21_V2.0840 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM21_V2.0840
Domain Number 1 Region: 363-435
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000269
Family PCI domain (PINT motif) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM21_V2.0840
Sequence length 474
Comment | organism=Leishmania_braziliensis | product=proteasome regulatory non-ATP-ase subunit 5, putative,19S proteasome regulatory subunit | location=Lbr.chr21:227974-229398(+) | length=474
Sequence
MADNEWKGASFKQDEDHSAETAKLLERVNATTIPVLLRSSNAKLDEIVAELLTLEKVSRL
GGDAASTKLLAVEVLRIYRTQKELELMLETLDMLMKKRGQTKQAQSAMIAECTIVLTDGS
LAKEKQEEVLERLAYVTENKIHVELEHARFTIELATLHEAAGRKRSACDMLRTLHIETIT
NMPRLEKLEALNQQIRLCLELEDYDHVPLVSRKINHRGLGRDEAQQQKLKYFDLMRAYYA
HKESFFNVGRCWYETYNTVKSTDDKLSALSNMVVHYLIAENATAKEIEDLAECTAFAPVT
KLHDRVAALSTISEKLKSDLEDIPQLYALLQRFNSIELIQERVSSEVEVLCQTHPELAPY
PARQELLSNRCSEHDIMVISKFYTRIPLRRLAELVHLSPEHTEMFIMTMVNNKTFYAKMD
RVDGLVVFEARKNTMEVIASWNDSVERSVALLDKASHLITKERMLHNLVPQKVR
Download sequence
Identical sequences A4HBS3
XP_001564791.1.15230 gi|154337116|ref|XP_001564791.1| psu|LbrM21_V2.0840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]