SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM21_V2.0950 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM21_V2.0950
Domain Number 1 Region: 106-362,436-464
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.31e-74
Family Creatinase/aminopeptidase 0.00000002
Further Details:      
 
Domain Number 2 Region: 363-435
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-19
Family Methionine aminopeptidase, insert domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM21_V2.0950
Sequence length 465
Comment | organism=Leishmania_braziliensis | product=methionine aminopeptidase 2, putative | location=Lbr.chr21:293086-294483(+) | length=465
Sequence
MPPKNASKNKQQPKQQGGNRKGKGSNDDTEDFDAMLAAAVSATMANTAKNHSNNNQAKRN
SSGNGATPANRCLAADEPVVPSSADHPENPYPKTESTYPRQTWPEPTVPVSKQFPAYRFP
AGEIVDHPGEMNNFRRSSEEKRALARANEQQLQEMREAAEVHRQVRTWAQSWIKPDLSLM
LMTDRIEKKLNELIGKDGIVRGQAFPTGCSLNHVAAHYTPNTGDEKVVVTYNDVMKVDFG
THINGRIIDCAWTVAFNPMFDPLLQAVKEATYEGIKQAGIDVRLGDIGAAIEEVMESHEV
EINGKVYQVKSIRNLSGHNIAPYIIHSGKSVPIVKGGEQTKMEEGEVFAIETFGSTGRGF
VNEDLECSHYMMQPGAEVMQLRSEKAQQLLKHIHKSYSTLAFCRKWLDRDGFDRHLKNLN
RLVDEGAVRKYPPLVDVKGSYTAQFEHTIYLGPTAKEILSKGNDY
Download sequence
Identical sequences psu|LbrM21_V2.0950 gi|154337134|ref|XP_001564800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]