SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM24_V2.2370 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM24_V2.2370
Domain Number 1 Region: 31-377
Classification Level Classification E-value
Superfamily Cullin repeat-like 9.94e-63
Family Cullin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 391-652
Classification Level Classification E-value
Superfamily Cullin homology domain 1.01e-49
Family Cullin homology domain 0.00028
Further Details:      
 
Domain Number 3 Region: 663-743
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.15e-24
Family SCF ubiquitin ligase complex WHB domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM24_V2.2370
Sequence length 743
Comment | organism=Leishmania_braziliensis | product=cullin-like protein-like protein | location=Lbr.chr24:803206-805437(-) | length=743
Sequence
MLEEDRQALRKMKADFEALADLANSDFKGYNTFERRMNHYNTVYTAATRNTSRAAEYPGY
DAGELLYMEYNEMLTTYLWRYRDLSGDSEKGLFQKILDVWDHYKILMKWNMRTFGYLSRY
YIVYHSKPSLQQVGLSIFLEQVFKKNADVVSSITQKLLLKERADRVVSTDAKQIATAIGL
FSSMNIEDTQSIYITAFLEPYLDKTKRDYERFLQEWDAAADAAVFLRSVHEALTNERSIC
RRYFSMQDEERIMTCVEATLVDSPVTRNKLVDSPTGVLAMLRNRDEAQLQMCNSFFSRRE
SGVALLAGLIKKQIEDEGLELCERFKDEEASVDVVAYTTGMMHLQEVYPQLLSRCFQLDF
TLSKAVREGLEACYNHGVSVTSSSGGESHVVPFCEWLSHYVNHLFQQEAGPASAEVDRIV
ATLAYVTERDRFIATSREHMADRILFPVKKFNEANERALIQRFRQRCGPACTACLESMLH
DWEASNSFRAMEVLASKNIISPFEVNLLVAKKGIWPSRLSDEPDIVVPSFLQRVLEPLRD
EYLAGKSGRVLTWSHECSSGELQGYFKKGTQLFYACGIQTLILLCFNSSPVCTPQQIGDR
CHVTFASLQRYLSPLIRSRVLTRKSGKALLQLDDELTVNDEFVCRARRMRLPPSLARVSV
VGSDRISKQVEEDRKPAIDGALVRIMKGRRSLEHAELILECQQHLSSRFSPDIKLIKQRI
EELIRREYISRDSRNKGVYHYIA
Download sequence
Identical sequences A4HDU0
XP_001565500.1.15230 gi|154338551|ref|XP_001565500.1| psu|LbrM24_V2.2370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]