SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM25_V2.1240 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM25_V2.1240
Domain Number 1 Region: 641-883,935-963
Classification Level Classification E-value
Superfamily Cullin homology domain 7.59e-38
Family Cullin homology domain 0.00029
Further Details:      
 
Domain Number 2 Region: 73-127,160-237,301-510
Classification Level Classification E-value
Superfamily Cullin repeat-like 2.96e-17
Family Cullin repeat 0.022
Further Details:      
 
Domain Number 3 Region: 988-1054
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000212
Family SCF ubiquitin ligase complex WHB domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM25_V2.1240
Sequence length 1055
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr25:489410-492577(-) | length=1055
Sequence
MTMFPRPHLPSFQVTLLPDLPPTQQHQRAGKTTSASPPPSLPFPSLASLQMHDEAAAKAM
LHAVLDMASDYTIPQRRFCSYSPEAVLRSVRALVDSDLCALLVEALQAAVRAYAQRCVAV
LLAQQQQLAPSAGAAQGMTNSDPESDEEAKTMATNAGLGEVQILAQLVTYWERLQEGMME
LSSVWVYADQWCSTQVGSAMPRSLTAAATQVIREVLSDYPGLCETALAGYVTVLRAELTA
DTEALLSASRSVCIPNPATLLDTRAVASSASAMRSVSSAPPLPSVEATPLVVLACPPSLT
SLDKPLRQRLLRLFTQLTLATQHYTAQVEPTVVRVVRSHYEKVARRLWADNVNARVFFRF
CDGVLKYIGPMSVSLLHSGTTLVLEEAIQGSLISMVGSEVLKRDFAALMERQEYRSLRLA
WRLLSASARVRSSPLVAGLFHEYLIDCGQRIMEELVPSSTKVTPAAALAPPCERPFLAVR
HLLGLLEQGSRTVEKCFAECERDFKVALHEDMQTILEAYPQAFSEQLAAYQDAIMKEVTV
GLVTAGSPKSTVPVEVENSDDDNGAEEDESPLCRPRAEGSSLSLRPPVAPPLLDATRAEE
DDGVSSEREELTGVEDAVEGDAVIGAAALRHAAPLPAEVKEVTSVLRRIAHIYSYHPKKN
MFEDAYWRDFARRCLHAHRKLNSTVENAFICFLRDICGLSFTSKFEGMLTDLTSSAELTT
QYSMWVQEQEQPSGEKGGGAAAMGHSMSGTKSLDAHLFILTKSYWPEYPPMPSSFYVPPA
VQAVTQQVEKFYTGLFPNRHLSWQYPLSHATLLTRLTPQSSVLTLTGTYTQCVLLMRLDA
LYDRGVTSITAKALCDAVGMDMANAEFLWSLQGLCHPRFALVLRKGVGSLVSAAGGAQCK
SVELDNEDDESGARVEGVVGTSASPQSASSGAAAGASASYAITATDSLQLNLSFTSAKSK
VRIPLQTRMRAMASVGFDGLSRGGRTADNGGHLVEVSIVSCLKAQRTVTRADLASAVAAQ
VPFPVTTAVLKKAIDKMIERGFMVRGKDSTYVYSA
Download sequence
Identical sequences A4HE70
XP_001565628.1.15230 gi|154338812|ref|XP_001565628.1| psu|LbrM25_V2.1240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]