SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM26_V2.2260 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM26_V2.2260
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 1.16e-18
Family Ribosomal protein L29 (L29p) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM26_V2.2260
Sequence length 127
Comment | organism=Leishmania_braziliensis | product=60S ribosomal protein L35, putative | location=Lbr.chr26:831781-832164(+) | length=127
Sequence
MSHHMKIKDLREKSKDDLLKKLTEYKKELSQLRVVQQTGGAEARLGRIRPIRKSIARILT
VLNQNERRNLKKFYSDGKMRSKMPKVLRAKLTHRRRLALKDNEKNRKTLHQLRQAHKYPK
RVYAVRI
Download sequence
Identical sequences A4HF78
gi|154339529|ref|XP_001562456.1| gi|154339531|ref|XP_001562457.1| XP_001562456.1.15230 XP_001562457.1.15230 psu|LbrM26_V2.2260 psu|LbrM26_V2.2270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]