SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM27_V2.1380 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM27_V2.1380
Domain Number 1 Region: 368-575
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 8.11e-47
Family Cation efflux protein transmembrane domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM27_V2.1380
Sequence length 663
Comment | organism=Leishmania_braziliensis | product=cation transporter, putative | location=Lbr.chr27:525483-527474(-) | length=663
Sequence
MEYTGCLFVTEAIRRSCSGWKIHACPPSLSILHYLDVILLSSLHSHTSPSTHQMHFPIAL
LGLAASACLVFTYHSARLSGTSIVWFSSFAALLTFFVRLPRVLWSKATACDIPREKSRLL
SAGACALLFVSGTYGLTTLGALRFACACACTAGAHHIAQLRRSQRHTKIACTVLSYIILV
FTSDPGKQNRTLMLYGLLGVFASACAVSLSMKEIVTKAGQTAFLFAACGLSLMGFIITLL
QRKPIVENEMLLLLAFCISGIVLAGCFTAGLRLQGSVTTFVAAIAGMSAASVVCGEKVFP
AVSDWESLALLTSAGLIFVAHKGLTFADASVVSLNVAPLNSAQMLKKTKQHCGNNSVIVT
LLSNPREYKLFVFLLLTVVIMLLEFIYGLAVNSLGLVSDSFHMMLDGTSIMIGLYAAHAA
SWLPDEKTHPFGYARYEVFGGFVNGILLLFIALYVMVESVQRFLDPPEIEGPYLLLVSVT
GLAVNVVGVLFFHDAHGHSHSALHEDGGGHVDHNMRGVYLHILADLLGSVSVIISSTLMY
MFGLWIADPICSAISAILVLLSAFPLLEETGRVLLLSAPSYERNYSDELRKVLLETALLQ
DVESPKLWMHSTAPRELTICTVAGKLRNNTDYTSAREKITETVTAHMLRHLDVHNVSLVL
HLE
Download sequence
Identical sequences A4HFQ2
gi|154339878|ref|XP_001565896.1| XP_001565896.1.15230 psu|LbrM27_V2.1380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]