SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM27_V2.1800 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM27_V2.1800
Domain Number 1 Region: 21-269
Classification Level Classification E-value
Superfamily Activating enzymes of the ubiquitin-like proteins 4.32e-88
Family Molybdenum cofactor biosynthesis protein MoeB 0.0000281
Further Details:      
 
Domain Number 2 Region: 300-444
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000746
Family Single-domain sulfurtransferase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM27_V2.1800
Sequence length 455
Comment | organism=Leishmania_braziliensis | product=molybdopterin synthase sulphurylase-like protein, putative | location=Lbr.chr27:698021-699388(+) | length=455
Sequence
MDASSSDNALPHGAFVSAAPTLTKDNVERFGRQMLVEEIGAAHMEQIRHAHVVCVGAGGL
GSTILLYLAAAGVGRLTIIDFDDVELSNLQRQVIHTTAAVGQPKALSAKASCLRLFPGAH
VDAVVEALTPSNAERLLATCDVVVDGTDNVAARYLINDAAMRCGKPLVSGSAIGWDGQLS
VYGYRGGPCYRCLFPQPPPPEAVGSCNDSGVMGPLPGMIGCLQALEVLKVATGVGETLSG
RLFLFNGLQFTSRVVKLRGRQPRCVACSATALADATPLADLAILARPEYVPKSCAAAYTS
SPPGRSCSASEYAAHMPGAAAAATAERCITLDVRARVQYDMAHLPHSVNVPYQSMQQWQR
AGTVVTHLSEVLEKALPPQSAAAHGGTVPEVMVYVLCRRGINSLKATALIRAALEEEQAK
GDRATAARLGQYVFQNVSGGLNAYHCEVDRGFPYY
Download sequence
Identical sequences A4HFU1
gi|154339958|ref|XP_001565936.1| XP_001565936.1.15230 psu|LbrM27_V2.1800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]