SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM27_V2.2720 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LbrM27_V2.2720
Domain Number - Region: 415-478
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.088
Family GntR-like transcriptional regulators 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM27_V2.2720
Sequence length 602
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr27:1065217-1067025(+) | length=602
Sequence
MPLFRVSDAATRPSEVCEDLVAKPIAAHYQLIISTITDQLGPLAGAVCRALTQSGPMSLK
DISDAVHRDEEVRAVAAAAANRASATGETTTAVPATHQLGSSFHVDLGDIASVNDVIHEV
AVKELVTRLVVHRLVHTDPVTHLYEMRYGSAILLRVLFPLLLHCARQRYGEAAKCVLLVA
YQLGVVPPRAAVQVALSRTPSLTHEAIEYAVVRLVEDGWLVPVPNLPTAAPDAATPALRA
DGASSHLGGSLDLWSATRPHCVGLQAALHCLFSDAIEQAVAERYADGRLALTLVRALRRR
TAPNSEYTEAVASFQELAAELPTTAGVRRDRSGEPRVGTDSVSSGSAEAVRRCLERLCQP
VALFAGCNAAAPMTPAAGSSPNFTTMPSTRALLVKPQSESDLYALDDVTAVQLLQEAVCE
RVVYSRYGVLGVRIMRLLLQHHFLEERTLAEQSVATYVKAREVLHRMFKDGFLLQQEVPR
TSALVERSAKASVYLWGLSWSATLLPAVRERLAKTLTIAWVKLREAQQQASAVAKPAACV
RSSPAASGGIKSSAAHAEEVEAQWKSGMSRSIQQALQTQRTITGLQSCVMSLMRLLLIVD
FF
Download sequence
Identical sequences psu|LbrM27_V2.2720 gi|154340136|ref|XP_001566025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]