SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM28_V2.2320 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM28_V2.2320
Domain Number 1 Region: 5-351
Classification Level Classification E-value
Superfamily Cullin repeat-like 1.39e-35
Family Cullin repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 385-597
Classification Level Classification E-value
Superfamily Cullin homology domain 1.57e-28
Family Cullin homology domain 0.0031
Further Details:      
 
Domain Number 3 Region: 637-716
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000107
Family SCF ubiquitin ligase complex WHB domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM28_V2.2320
Sequence length 717
Comment | organism=Leishmania_braziliensis | product=cullin 2, putative | location=Lbr.chr28:851390-853543(+) | length=717
Sequence
MCNTVMDAYLLVYHLISHPCSNTPLVKVNGKEIWEGQQIMAVYSLQGTILEKHLLSNVMP
AFSQVSSGSTIQTYVRSWRSFLVAVVNIKTVFSSLADKWSLLSLEDSPLDRTEDIALRKW
SSVVLTPRMVSQLRKDLRALLADERAGYGSPDLSFAVEIKDELSMLPDSNYYRSVVEADY
IRDMCDYCRLKVRGVAESDLFAYAKLCLGLIEEEVRRAEKFLISKDHAVDRLVETLVDDR
ISVFECGKFSEWLSSLGQPETDEKLKTVFHLLWWSKCKGAPLMEGMFKESVAQHTSTALS
GAVCAAGEGTDAYAAVIECFISIIRKYRDVVMSVFDYNGCMLEAMDDGLRCGFTTLRSFS
YKKLSDRLAAFFNAILGNAGSTKLCLEDVVSVYYFLPDAENSAKDAFLVSYQKHLAKRLL
LHHYDEEREQRSMEQLVQIKQSPILFCCRSMLKATSTQSIYVGASSVNGVKVNPALLSRG
TWPSLPHTLARSGISDSVLRQIEGAQRICSERRHGQKIEYSAPYSSAVIRMLRPAGSTAA
GDSVQLKVSFLQMCIIDHFNTKSQWTVKELCELLQVSEVECAFALDPLISATVLKLSGAM
GPSSVVSLGTCDSLIGDMINVMPLEFHSFTHRVAVKSQEQRILQGVAKANPQRMESQVVH
TLKQSGSKTAEELMTFLTSAKDPLTVSRGELKRVLEKLIERGLLVRDDSQRKFVYSP
Download sequence
Identical sequences A4HGR6
gi|154340607|ref|XP_001566260.1| XP_001566260.1.15230 psu|LbrM28_V2.2320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]