SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM28_V2.2510 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM28_V2.2510
Domain Number 1 Region: 312-386
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000435
Family Transcriptional regulator IclR, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM28_V2.2510
Sequence length 405
Comment | organism=Leishmania_braziliensis | product=eukaryotic translation initiation factor, putative | location=Lbr.chr28:918246-919463(+) | length=405
Sequence
MDMLMKLLPYMDKHLALGLLNHYAQNGEDVQDSMIKLIETTGLNADGSIKAETEEMMAKA
TAAAQPALKEFFDPSEDDHSTYQFKLTETEIGERRTQGELSHEFLSEKKGITAAVMNAVY
RLAYLYYDTGAYGDASELLALCQCVSGYDSLRSDTILWGKLMSDIGAVNWQSAMRIAEEI
RRLHNASEEDLFGAPNTTTVRARVWLLHWVLFPFFKGGLQYSLQLLYFIFDHRHDQTYRK
TVETVCPHYLRYICAAVLLHRSRYSNFVSAAELVESIYEYSDAITQLVNLIQKASFEDAI
ALLPEVRRVIREDYFLADYEEELIENAKRMIFSKYMSLHSVVSISYVAEQLDMSKADAEV
WLVNLISESVKHRAKIDSVNEQLNVEPQTRSLESLIYDKLDAVLR
Download sequence
Identical sequences A4HGT5
psu|LbrM28_V2.2510 gi|154340645|ref|XP_001566279.1| XP_001566279.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]