SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM29_V2.1400 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM29_V2.1400
Domain Number 1 Region: 66-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000789
Family RPO3F domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM29_V2.1400
Sequence length 447
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr29:519938-521281(+) | length=447
Sequence
MSLLPSMTVEQRILHWLSTSAEEAIPYERLKRELQLGSSGGEGAVRQLMEQNRVRLRRGN
GADTQIYISIVNNINESLSLVLDAVRASGAGGIDQTQLLSKVRMPKTELGKALTALTAKN
LIKEHRSFTNRAKRIYTLFNIDPSSHITGGAMYCGEELDVAFVDEWRRELTRFVSTRRMV
SFDQIKRHVEALQSAGGGRGGGSALPTPGLVVNHSSGTSTQPSKLPVVFTMIDSAVQRTV
GGGPSSMSGMASSSSSYAVVSKQLSDLDLRILVHTLVLDGVLEMLIPATTEGVNTPQYQL
AYGQSVMRHFTAQVRRPRQRCLSTGIEGPALQRARQENDLALGFPGHPSATPSSSPPAAT
GGGWSGFIPDIEGDGLSSSTMEVLSQSSLWEPAPVSQPSSKDAVDGWSYMPAVGFPCLGC
PLLEQCSVSCRGVVNPKSCTYLKDWLS
Download sequence
Identical sequences A4HHE3
XP_001566484.1.15230 gi|154341062|ref|XP_001566484.1| psu|LbrM29_V2.1400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]