SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM30_V2.0340 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LbrM30_V2.0340
Domain Number - Region: 141-231
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0815
Family Single-domain sulfurtransferase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM30_V2.0340
Sequence length 541
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr30:101399-103024(-) | length=541
Sequence
MVPYVAHAYLITHRQSLMMLKTKQTLAEHLDKMKFTLPACKADAIDPELVDGRATAPIRV
WSGKSLLQNADLLYRVTPLSTQRMLDFCLFPDVGLLNKTPEELQQYYAETPILPLERSDI
ASAFAKRGAATEEGDYKFPSREYVIADCRSQESFEYVRLSTAILVGDVLSYHHERLAEAM
RRLESCRGHPLALYGTGRPIVEEVNLLKMFALYLVNQKAFPFVCIVPGGFKTTIPLLRNH
IIDAIMSPAAATALETATSKRGAFSTEWAQKASNTAHTIAAALSGASHYLAQVEVTEVRQ
KAQELGTKAKEGMTAAGSWGWGMMKRFREGLTETREQALTALSSAGSKLAAAQTATATNT
NLAPSSTADPGSSSATAPSAASKGSASGEAVIPTATAHPAAAPSWQHLQQVFSLGEDGEE
EDLDLITHIPARVPRGTVVAESTPVAAEVALSASAAASSAAAVSTPERRRLPAPAPSPAL
MASPKLLSSPTSSAAPAAAMEANRASAALIAASIDAEFDELFGDLTVTPAAATHAVNATP
S
Download sequence
Identical sequences A4HHX7
gi|154341431|ref|XP_001566667.1| XP_001566667.1.15230 psu|LbrM30_V2.0340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]