SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM30_V2.1480 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM30_V2.1480
Domain Number 1 Region: 96-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-27
Family RIO1-like kinases 0.00039
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-24
Family Rio2 serine protein kinase N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM30_V2.1480
Sequence length 486
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr30:488765-490225(+) | length=486
Sequence
MVKLDVTLLRFMEDEDFRVLTALEMAMRNHDVAPTALVERIAQLPHGGCRKRLNNLLKHK
MIHHENTMYDGYAMKYGAYDYLALRTLSKRGTCTGVGHRIGCGKESDIILVRDETGHDCV
LKLQRLGRCSFRSVTRNRDYKGNGRTRHGESWFYLSRLASQKEYSFMKLLYDEGFPVPKP
IDQNRHALLMELVPGTLLNNITELGDASKVYRRALELMVKLAESGLIHGDFNEFNLMITD
EQRVIMIDFPQMISINHPNASELFDRDVQNLANFFQRRFKVDTTWFPMLTKDVVRKGELD
KQVYASGYFTRKQQEDLERLMQEGFQRGEKCDSEAASRDRDSDASKDDGDGNASQNFDVN
SVDVNEGGVGKLTSIPGGANGGEENEEREEGSDDDVSESRWLDEAMNAARVRRQGEFYPR
NVHRNANFLSDGNINEDHVKHQIRRTIRCRENSDFNRHLHRNVQKGRQKQKIQRQLKSSK
GEGFFD
Download sequence
Identical sequences A4HI88
gi|154341653|ref|XP_001566778.1| psu|LbrM30_V2.1480 XP_001566778.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]