SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM31_V2.1950 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM31_V2.1950
Domain Number 1 Region: 798-914,956-1097
Classification Level Classification E-value
Superfamily Cullin homology domain 0.0000000000000671
Family Cullin homology domain 0.016
Further Details:      
 
Domain Number 2 Region: 1123-1198
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000019
Family SCF ubiquitin ligase complex WHB domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM31_V2.1950
Sequence length 1198
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr31:845925-849521(-) | length=1198
Sequence
MRFGTDFTEEELAELKKLDIIYDKLLPKRSSECKDASTSSTNGPGDYGRIPLRDFFVSSA
GTPSVARIGSSPPGIAAKWQMMLREMNGEMVVRNGQNIRNTRAVTNRILSWSITFQQADR
AAAAVSLGHDGGRALAREWVRGIVVYFQERMDKSFAELNITAQEEAFVRELKLPEMDGAD
LVSRCVEAARTVITPMLTMSPYFISIVRCCREMVLALKVVQGLLSHISSHTRLMPPTTVA
ITPNGRRNVLSILTLGEDFLESLRTPLWLFRSVLLFLGALELQQSPQREIAISEQHLDHS
IHCIASLVAEVESKRDGSTTANLEVRTILDALVLGHVKNACLSRFPPSKMLKLLEHEQGV
LADVEAPDVANNLFARCGPVLKQLLIDYPTFMESTAKFVERNEMSDWGTSLMLVQLFCWD
VKTPPDLATQAKQPVLYHVPKMTGPFPHGSTVLSAMVREVLRPLLSVLLSGIPSGAKDDG
ASGGATGTEIDTRASDQRAVANPSHPSTAGGCDAPLVLSPFEQNVCAALLTLAAWLQSLS
FPPGPRMPKWASLDVGDQIMREFNLGEGCFKSVLGEVLQDVIAEALGQVGNNCSHRSATG
AAAAPETDDTASQLSTAVLQYLRRVECVWNAVTEHSLELCPSAFSDILALGAQIPSSIST
ASAFHTTADANATAVRASYNTGLFGDCKYLFYDTVQNVMKTMWPNRYADLLTDPLLHSVH
VYLLRAESTSQRSGGLRPVSPSVAQGRPIGAKRPKPLPEQASKEPASHPVSPGAAAAPAR
GSPPGAAEQSAVVLTSKEELHSALRMVRCIKNRDLFVSRYTVTVRERLLTRPAPDVISDA
ELQSNKKRHEQEAMQFLATWLGDASLLKPVRELHMSYSAQSELFKPASKGPVEATEVPTK
GIRLTTTILDWRLWGDKEAAPATVPGQAGESGAAPSPFPMSAVELVARAGQALSMATSAT
APLPFPNDALVQLEKVELAYNEKHSNRMLRWDWNDHAYTTFTLSYPKEGGRVTTIHSTLL
LQRLFLAIAAYGRTGVELATLAKRAGMDERRIAAILRLCLDRDKLLVRISNSCDGVGAEA
ASGKVCIALNYDYTRPPSRLRGEFTYWPNAERRRVVPGTMDQDATITKRRNMIKTSIMQV
MKHGQRIKHDELYNTVREKNSKVFDVTVRNFKQEIEGLIGQDFMARSGTNSNEYVFRA
Download sequence
Identical sequences A4HJF4
XP_001567191.1.15230 gi|154342486|ref|XP_001567191.1| psu|LbrM31_V2.1950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]