SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM31_V2.2680 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM31_V2.2680
Domain Number 1 Region: 53-204,262-343
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 2.48e-36
Family Cation efflux protein transmembrane domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 351-418
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.00000000301
Family Cation efflux protein cytoplasmic domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM31_V2.2680
Sequence length 443
Comment | organism=Leishmania_braziliensis | product=zinc transporter-like protein | location=Lbr.chr31:1241225-1242556(-) | length=443
Sequence
MSAEQPGETTGLTVAFAGPSVANYHAASTPAYVTVAEERTIDEALSAVEARRESEKKVLL
GALIFCFVFMLVEFTSGVMAHSLALLTDAIHLLADVGSYALSIGALVAAGRAACGRYSYG
WHRAEVIGTLISVFSIWALVTWIVIEAGYRTYDIYMCSRVPAQVSAGVRSVRDCQAVDSR
LMIVVGVLGMVVNVVCASILYFGGSHGHSHFGSSHGHSHDGSGEHNQDHIHEDDHDHGHD
HNHDHDHDHDHGHATQSGGSIGSHKGFAVHAAILHAMGDCVQSIGVILAGIVIYLCNLAY
YGKHTYEHSLFNLADPFCSVMFAVITLNMTKALLMDLFGILMESTPASVDYSALDAALRQ
IDGVVDVHDLHVWSLSAEYVSLSVHLVADDSADALHKAQHICSAHFGIRHTTIQVDPVAI
GAAGCASACASPTVHDEVSSHYM
Download sequence
Identical sequences A4HJM3
XP_001567260.1.15230 psu|LbrM31_V2.2680 gi|154342624|ref|XP_001567260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]