SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM32_V2.0960 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM32_V2.0960
Domain Number 1 Region: 213-491
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.14e-65
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000025
Further Details:      
 
Weak hits

Sequence:  psu|LbrM32_V2.0960
Domain Number - Region: 8-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00454
Family MarR-like transcriptional regulators 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM32_V2.0960
Sequence length 500
Comment | organism=Leishmania_braziliensis | product=phenylalanyl-tRNA synthetase alpha chain, putative | location=Lbr.chr32:339619-341121(+) | length=500
Sequence
MTEQVSIEATILKALSSTERVFSTDVAESIGADHQDVVGAGKSLEADNYIHSEMEQRMVL
KLSSEALQIMESGSPEYRVWSLLKDDKMSQEDVASKLGKEVTGVALANGIKSKMFKTTKE
AGKVFLERVPGSENVVDTVRELLKETAAAANQIDAKAMETLKKRKLAAMEAKKVFVYTKG
PSYAVERAAKAVGDLTREMLADGSWKERQFKEYNFSAQGADVGGGALHPLLKVRQEFREI
LMELGFQEMSTQHWAEVSFWNFDSLFIPQQHPARDLQDTFFLSKPETSNVSDLEYVERVK
AQHEESFRTPWKLEEASRNVLRTHTTGSSAFVLKNLAKCAKRGPDGKLHFTPGRYYSIDR
VFRNEEMDRTHLCEFHQVEGCVIDRDISLAKMMHTFDSFFRRIGVSQLRFKPAFNPYTEP
SMEIFGFHTGLNKWIEVGNSGLFRPELLRPMGFEDDVAVMAWGLSLERPTMIKYGINNIH
ELFGHRVDIRSIKRAAIARY
Download sequence
Identical sequences gi|154343015|ref|XP_001567453.1| psu|LbrM32_V2.0960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]