SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM32_V2.1350 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LbrM32_V2.1350
Domain Number - Region: 188-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0571
Family Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM32_V2.1350
Sequence length 274
Comment | organism=Leishmania_braziliensis | product=proteasome regulatory non-ATP-ase subunit, putative | location=Lbr.chr32:480033-480857(+) | length=274
Sequence
MSTVGDLSITVRNIAEDVKNLKAAYETKNDSQCIAILSKIKRRIIMFPTFLNPGASSSTR
SEELSLARTYLELGVLASAHQKDLASFEVYFNQLQLYYSDIGSDELPESPQYLMLLGLNL
IRLLVCSRIAEFHSEMEKIPFATHGSNLYIRFAVGLERYLMEGSYNKLLTSRKKVPSNEY
LPVVEMLEQTVRDEVANCIPESYKQLSIPAAQRILMVDSETKVREIGAAREWTLSEDGTH
FLFTREDDTLKREIPFREMIEQHINFVADLQNIV
Download sequence
Identical sequences A0A088RXX2 A0A1E1J3L7 A4HKA7
psu|LbrM32_V2.1350 XP_001567492.1.15230 XP_010701813.1.42505 gi|154343093|ref|XP_001567492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]