SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM32_V2.1560 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM32_V2.1560
Domain Number 1 Region: 28-63,92-114,165-253,285-336,373-466
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.4e-39
Family Tandem AAA-ATPase domain 0.00063
Further Details:      
 
Domain Number 2 Region: 710-891
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.62e-28
Family Sec63 N-terminal domain 0.0098
Further Details:      
 
Domain Number 3 Region: 485-570,598-617
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000212
Family RecQ helicase DNA-binding domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM32_V2.1560
Sequence length 1678
Comment | organism=Leishmania_braziliensis | product=DEAD/DEAH box helicase-like protein, putative | location=Lbr.chr32:560568-565604(-) | length=1678
Sequence
MCTPATKCLGELLDFLPHHRFTKVQEAVIPALFTNDLNCLVAAPTGSGKTMLLEVAMLRL
FRSVLAPERGAHARVTHKDDETCNLARPLLQRKRKAVYICPIKALANEKYEQWRAQFPSL
TVAIETGDKQQQQVNRQERLGPTTITGGDGRGSDALANMGCVSQADILVTTPERWDSITR
RWKEKEVMAIVNSVGLLLLDEVHTVQEERGAAMEAIVSRVKIIQASSTSMHQRSAAEATV
TRIIAISGTLPNSRDLAEWLQVSPEMTFTFAPSDRPVPLTIRVIGYAHDSPNPFAFHRFL
SFKIFALMQQFSQGRPTLVFCASRKETASSAQRIVEDIREAATRQGRLAQLQPSAEAQQM
AQLASDKQLRSCLMMGVGFHHAAMTMEDRQLVERMFREQYIAVICTTTTLALGVNLPAHL
VLIKGTTFFSSGQCQDMPVSEVMQMCGRAGRPGFDTHGMALVLTMQRSVHLYETLASGAV
ALTCVESHLHRHMIEHVNAEVALRTIYSFPSAMEWVKTTLLWIRLRKCPAHYGLKFVNRA
EELEFNAEAFVEALMERVLRVLMEEGCVRLSHTNALVLSSARETATSVAASDMEVVKDPS
AVFEATRLGRAMSRMYILFDTVCTLNSKLRDRGAPSTNGDAPEEDSGPDACPGAVDVREK
TTAQAVAMSVEEVPEHSSAKMHTSPEGMQPQSSATDAPTCSSKRQMMPFNLREVLQLLCN
CQELVEVRLRQGDRGPLNELNKSVKYPLHSGRRGGREVREDWQKAFVLIQAHIELLSFAE
VSLRNDSLRLWAVVPRVSRFLEEYAWAATTSYSLAVHANVLARCIERRVWPDGLVLRQLK
HVSDSVAKTLLRSGYRAFESLGSVDARQLEVLCSRLPPFGSQVLSEVRRLPRISLDLSST
ASAAEADGIHERHRIVSGVVKLTLSQYAEAAPDENVLDAERRQSSVAASSRTPHGQPQLL
SGMAAPDSARVLLLVGIPSEDRVLLKRFVPLSTLVSPSAAQSTALAVAAPGCCPGTRCFS
FVCPPSSRNTSRGGGRGRHIEARCLVLHVVGMDTVTVWDEVLASDRDGADGEGIQGVAQR
PVLNASVPIPAPKGIALLPHRSAPQTELSVQVAIEARTTFNELLEDLKYVTGVGETMQPH
RTGPRQPLASRKRTRSGNDACITAQDGQETPSKEGRDRHDIVAATLPLSATASATSMPSV
PDVSKLRNADVNASTGAAAAKPSQERPAAAGSSLDSAHSSPEHRAGQAALLEVPLLDKST
PQHLRDFPSKSVMESPSLRMETTEDLVASTSSAVHQGPTRVRLQPCTSPPASRPPKTAGA
SLRACFPTLQREMPYPTPQVTPLMPKHSQSYCGIPPYVTASAEDLSPQPVSCTTPWSRQG
LHSMVARTPLSSSRFVVRVASPHASFHPRRGDAHSSTDQRSNVLGQQEALYYPLDSRQAP
SDMRYAVTGMQGEWWRPNCVQDPSWVHGAPAPSHQYPYSTPPMRTRLGHYESTQTQLNGV
GYFPAQWEHAGAPPASRLGLQHLPSFFAPQPPIQFASEPQQMWQTRSQLPSYPPSQEPSV
SQLHPPSPSDPYPPSKTPPWHRLPPSAVYAPLAWHPSAPIQPRPAPPSMRAPITQLHQPP
HVAVMSSDLHATTSPSDRFVYRANASVGRLASVPTSGSGDFAPQVRRRSSMVVQSWWQ
Download sequence
Identical sequences gi|154343135|ref|XP_001567513.1| psu|LbrM32_V2.1560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]