SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM32_V2.3060 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM32_V2.3060
Domain Number 1 Region: 306-382
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000952
Family PCI domain (PINT motif) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM32_V2.3060
Sequence length 408
Comment | organism=Leishmania_braziliensis | product=proteasome regulatory non-ATP-ase subunit, putative | location=Lbr.chr32:1129253-1130479(-) | length=408
Sequence
MSSPPPPRNIEEDLQRNEEEEPAPEVDDADIPVDPLLTLLYIRHTLTSPWSSSEEREAAK
TALMEEMEKHNMAPYIRLVCEALGVPLDESKLAEMDAINAKKVAAFDARLKDAVDNLGDT
EVRDVLQAKCDHYARIGDLEMCMKTNEECAAKTLATGPKLDLYFQRIRLGIAFSDNDIAA
KGITDAHRLMKDGDWERRNRLRVYEGIYHVFIRDFQRGSALLLDSITTFASGELLTFQEF
VFITVVASLPVLSRLELRRRIVYSPEVNRTSVDDVRDLVNSIYDCQYNKVFPNLEVVCQH
LRKVVYLSPHVSYFFREMRVLIFTQFLDSYSSVTLESMGAAFGIPVPALDSMLCTLISNE
RIACKVDRVDGSVETYRGDTTNFDYHRIVKSGDLLLNRIQKLSRLVDM
Download sequence
Identical sequences A4HKS3
psu|LbrM32_V2.3060 gi|154343425|ref|XP_001567658.1| XP_001567658.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]