SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LbrM34_V2.0820 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM34_V2.0820
Domain Number 1 Region: 75-260,303-388
Classification Level Classification E-value
Superfamily ApbE-like 1.07e-51
Family ApbE-like 0.0038
Further Details:      
 
Domain Number 2 Region: 428-709,886-944
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.64e-51
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 698-862
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.04e-31
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00055
Further Details:      
 
Domain Number 4 Region: 1049-1185
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.06e-26
Family Reductases 0.0012
Further Details:      
 
Domain Number 5 Region: 936-1039
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000000559
Family Ferredoxin reductase FAD-binding domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM34_V2.0820
Sequence length 1194
Comment | organism=Leishmania_braziliensis | product=NADH-dependent fumarate reductase-like protein | location=Lbr.chr34:329251-332835(+) | length=1194
Sequence
MGASAMATQRRCTVSDSHTGASIVVVNPEKAARERDRIARDLLTTNFPELHVNQRSVLLY
KDVVHTVPYTLSIAVDGSVTRQDADPVVKAILSNCFTMVDTHLNSFNPDSEVSKVNRMPV
GEKHVMSEHLCKVVKCCEEIYNISGSCFDPAAAPLVHRLRNAARRQDSTEADFMITAEVA
GRFTLTNSFAINVKEGTIARKHEDAMLDLGGLNKGYTVDCVVDQLNAANFSDVLFEWGGD
CRASGVNVQRQPWAVGVVRPPSVDEVVAASKSGKSVTMNAHSLGERSDEPAQSASAADGA
AKPGHKTLLRVMSLSNEALCTSGDYENVLFVNALNRAVSSTYDWRHRCLIGPSQGGLAQV
SVKCYSCLYADALATASFVKRNPVPIRYMLEHYRRDYNRVTDYTAYTREGERLAHMYEIA
CESPACRTERIAGSLPARVVVIGGGLAGCAAAIEAASCGATVILLEKEARLGGNSAKATS
GINAWGTRTQAVNHVLDNCKFFERDTFLSGKGGHCDPGLVRTLSVKSAEAISWLESFGIP
LTALYQLGGASRPRCHRAPDQKDGSPVPIGFTIMRHLENYIHTKLQGKVTILCETAVVSL
LHDVSAMPDGSREIRVRGVRYKSTSDASEAVIDLPADAVVLATGGFSNDQTVNSLLREYA
PNVYGTPTTNGAFATGDGVKMARQLGARLVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL
RGSGGILLNRNGERFVNELDLRSVVSQAINAQDDEYPNSGGSKFAYCVLSEEAAKLFGKN
ALTYYWKSQGLFTRVDNIKALAELIGCSVDNLHRTLETYEHQSTAKVACPLTGKLVFPSV
VGTSGPYYVAYVTPSIHYTMGGCSISPAAELLMEDHSVNIFEDMRPILGLFGAGEVTGGV
HGRNRLGGNSLLECVVFGKIAGDRAATILQKEKYGLSKDKWVPVVVRETRASDQFGVGSR
VLHFNLPGATQTSGLTVGEFISIRGDWDGQHLIGYYSPISMPDDKGRISILARGDKGNLQ
EWVSSMRPGDSVEMKACGGLRIELKPQQKQMIYRKTVIRKLALIAGGSGVAPMLQIIKAA
LSRPYVDSIETIRLVYAAEDEYELTYRSLLKKYRTDNTEKFDCDFVLNNPPEGWTEGVGY
VDRATLQSFLPPPSKGLLVAICGPPVMQHSVVADLLALGYSAETVRTIDEDRML
Download sequence
Identical sequences A4HMB4
gi|154344505|ref|XP_001568194.1| XP_001568194.1.15230 psu|LbrM34_V2.0820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]